PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID kfl00801_0040
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Klebsormidiophyceae; Klebsormidiales; Klebsormidiaceae; Klebsormidium
Family EIL
Protein Properties Length: 718aa    MW: 77803.9 Da    PI: 6.3002
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
kfl00801_0040genomeKFGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3394.41.5e-120604352353
                    XXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
           EIN3   2 elkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsLraWWke 97 
                     l++rmw+d  +l+rlker ++    ke a ++ ++++s+eqarrk+msra D iLkYMlk+mev++aqGfvYgiipekgkpv gas++LraWWk+
  kfl00801_0040  60 GLERRMWRDMWKLRRLKERLRR----KEGADEKPQQKQSQEQARRKQMSRAHDEILKYMLKMMEVYKAQGFVYGIIPEKGKPVGGASENLRAWWKD 151
                    589***************9997....66667789999*********************************************************** PP

                    XXXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHHHHT--TT--.- CS
           EIN3  98 kvefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwgelglskdqgtp 193
                    kv+fdrngpaa +ky+a+++ + g+ + q+ +  +++sl elqDTtlgSLLsalmqhc+ppqrr+plek v+pPWWPtG+e+ww+++gl+   g+p
  kfl00801_0040 152 KVRFDRNGPAAAAKYAAEHASQWGGPNPQSPPAPTPSSLAELQDTTLGSLLSALMQHCTPPQRRYPLEKEVAPPWWPTGEEEWWPQVGLPPGSGPP 247
                    *****************999999999999*9***************************************************************** PP

                    ----GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXXXXXXXXXXXXXXXXXX...XXXXXX. CS
           EIN3 194 pykkphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsahssslrkqspkvtlsce...qkedve. 285
                    py+kph+lkkawkv+vLtavikhm+p+i+++r+l+ qsk lqdkm+a+es+++l+vl qe ++      h        p++ +s e   +++dve 
  kfl00801_0040 248 PYRKPHNLKKAWKVGVLTAVIKHMAPDISKVRKLVQQSKGLQDKMTARESATWLAVLAQEGAQNGGGGHH-----GPGPAMMVSGEgsaEDYDVEg 338
                    ************************************************************8755433333.....345555555431114555555 PP

                    ..............XXXXXX.XXXXXXXXXX...............................XXXXXXXXXXXXXXXXXXXXX......XXXXXXX CS
           EIN3 286 ..............gkkeskikhvqavktta...............................gfpvvrkrkkkpsesakvsskevsrtcqssqfrg 336
                                  g               +                               + p+  ++++ p+e+     +    tcq   +++
  kfl00801_0040 339 pakpspplvitslpG---------------EdegekasprtglgvldhgnrgvansssvsiaSPPLGPRKRASPGEQPHSGGT-LLFTCQYIMCPR 418
                    443333333222221...............13444555566777888888999999999998888888888777777776655.78********** PP

                    .XXXXXXXXXXXXXXXX CS
           EIN3 337 setelifadknsisqne 353
                    +e  + f+++ +++ ++
  kfl00801_0040 419 HEAWNAFPNRAARNAHQ 435
                    **************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048735.9E-11460307No hitNo description
Gene3DG3DSA:1.10.3180.105.8E-66184309IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167683.92E-57188308IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001666Biological Processresponse to hypoxia
GO:0009873Biological Processethylene-activated signaling pathway
GO:0042742Biological Processdefense response to bacterium
GO:0071281Biological Processcellular response to iron ion
GO:0005634Cellular Componentnucleus
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 718 aa     Download sequence    Send to blast
MAQGQDVKRR ASTLEGEWLK SLAANVGEQC GEQSTVDIAD MLDASLQDDE VSDDEVDVEG  60
LERRMWRDMW KLRRLKERLR RKEGADEKPQ QKQSQEQARR KQMSRAHDEI LKYMLKMMEV  120
YKAQGFVYGI IPEKGKPVGG ASENLRAWWK DKVRFDRNGP AAAAKYAAEH ASQWGGPNPQ  180
SPPAPTPSSL AELQDTTLGS LLSALMQHCT PPQRRYPLEK EVAPPWWPTG EEEWWPQVGL  240
PPGSGPPPYR KPHNLKKAWK VGVLTAVIKH MAPDISKVRK LVQQSKGLQD KMTARESATW  300
LAVLAQEGAQ NGGGGHHGPG PAMMVSGEGS AEDYDVEGPA KPSPPLVITS LPGEDEGEKA  360
SPRTGLGVLD HGNRGVANSS SVSIASPPLG PRKRASPGEQ PHSGGTLLFT CQYIMCPRHE  420
AWNAFPNRAA RNAHQASCAF KVEEGGVGGG REAPRNENGG LMKSELRQWE ARLGGEAHGE  480
AGPHAPPHDI FKSPDLLPLH YPNDIFAGLF SEGGEHVVEK GGGQFGNPLD SFSLDALDGL  540
DGQHWGGEAA VQFPRPVTPL EEVGIDGAFH THLPGGQHAP HHHPPVLMGI DHSEQRQRAA  600
QSHTPQGFGS FQGFSGGALE NSLPPTNVQH DSLSMYTTSG LLEQIPQTAA QQGHEQRSTD  660
WLGLQQAEML FGSGVPFALE PPKRPSRQAS VAGSLVGDQS KSPESAAVSE MGDSEFVW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4zds_A2e-621863072123Protein ETHYLENE INSENSITIVE 3
4zds_B2e-621863072123Protein ETHYLENE INSENSITIVE 3
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00367DAPTransfer from AT3G20770Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002276380.11e-143PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein
RefseqXP_004140927.11e-143PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein
RefseqXP_010659025.11e-143PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein
RefseqXP_011656591.11e-143PREDICTED: ETHYLENE INSENSITIVE 3-like 1 protein
SwissprotO246061e-133EIN3_ARATH; Protein ETHYLENE INSENSITIVE 3
TrEMBLA0A0C9RQ591e-144A0A0C9RQ59_9SPER; TSA: Wollemia nobilis Ref_Wollemi_Transcript_3637_3249 transcribed RNA sequence
STRINGVIT_13s0047g00250.t011e-143(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5631682
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27050.13e-85ETHYLENE-INSENSITIVE3-like 1